General Information

  • ID:  hor003819
  • Uniprot ID:  P10000(179-195)
  • Protein name:  ??? melanocyte-stimulating hormone
  • Gene name:  pomc
  • Organism:  Oncorhynchus keta (Chum salmon) (Salmo keta)
  • Family:  POMC family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Oncorhynchus (genus), Salmoninae (subfamily), Salmonidae (family), Salmoniformes (order), Protacanthopterygii, Euteleosteomorpha (cohort), Clupeocephala, Osteoglossocephalai, Teleostei (infraclass), Neopterygii (subclass), Actinopteri (class), Actinopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007218 neuropeptide signaling pathway
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  DGSYRMGHFRWGSPTAI
  • Length:  17(179-195)
  • Propeptide:  MVCAPWLLAVVVVCVCNPGVGGQCWDSSHCKDLPSEDKILECTHLFRSGLQDESPEPRSAAQQSTEESLSLGILLAALTSGERALDADPEPHSDKRHSYSMEHFRWGKPIGHKRRPIKVYASSLEGGDSSEGTFPLQARRQLGSWEDEMVGALGNQGAKAQTKVVPRTLTVTGLQDKKDGSYRMGHFRWGSPTAIKRYGGFMKPYTKQSHKPLITLLKHITLKNEQ
  • Signal peptide:  MVCAPWLLAVVVVCVCNPGVGG
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Increases the pigmentation of skin by increasing melanin production in melanocytes.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P10000-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor003819_AF2.pdbhor003819_ESM.pdb

    Please select some value
    Remove Label
    Add Label

    Please select some value
    Remove Label
    Add Label

Physical Information

Mass: 222371 Formula: C86H124N26O24S
Absent amino acids: CEKLNQV Common amino acids: G
pI: 9.35 Basic residues: 3
Polar residues: 7 Hydrophobic residues: 4
Hydrophobicity: -70.59 Boman Index: -3552
Half-Life: 1.1 hour Half-Life Yeast: 3 min
Half-Life E.Coli: >10 hour Aliphatic Index 28.82
Instability Index: 4680.59 Extinction Coefficient cystines: 6990
Absorbance 280nm: 436.88

Literature

  • PubMed ID:  7440063
  • Title:  Isolation and Structure of Another Beta-Melanotropin From Salmon Pituitary Glands